Hostname: page-component-cd9895bd7-fscjk Total loading time: 0 Render date: 2024-12-18T14:24:31.719Z Has data issue: false hasContentIssue false
  • English
  • Français

Glufosinate metabolism in excised shoots and leaves of twenty plant species

Published online by Cambridge University Press:  20 January 2017

Carin Jansen ,
Ingolf Schuphan  and
Burkhard Schmidt
Carin Jansen
Affiliation:
Department of Biology V (Ecology/Ecotoxicology/Ecochemistry), Technical University of Aachen, Worringer Weg 1, D-52056 Aachen, Germany
Ingolf Schuphan
Affiliation:
Department of Biology V (Ecology/Ecotoxicology/Ecochemistry), Technical University of Aachen, Worringer Weg 1, D-52056 Aachen, Germany
Get access Rights & Permissions [Opens in a new window]

Abstract

The metabolism of the herbicide 14C-glufosinate (GA) was studied in excised shoots and leaves of 20 weed and nonweed species; GA was fed through the xylem. After 24 or 48 h of incubation, the plant material was examined for phytotoxic symptoms, analyzed by autoradiography, and extracted. The extract was cleaned up and analyzed by high-performance liquid chromatography. GA and its metabolites were identified by cochromatography with authentic 14C-labelled reference compounds. 14C-GA was rapidly absorbed by the excised plant parts. Most of the radioactivity (91.3 to 99.7%) in the shoots and leaves was extractable. The main metabolite observed with all species was 3-(hydroxymethylphosphinyl)propionic acid (MPP); lower amounts of 2-hydroxy-4-(hydroxymethylphosphinyl)butanoic acid (MHB) were also found in 14 species. Metabolic rates of GA varied considerably ranging between 13.1 and 2,836.5 ng GA h−1 mg−1 protein. The species with the highest rates of metabolism of GA were Galium verum (2,836.5 ng GA h−1 mg−1 protein), Lythrum hyssopifolia (846.0 ng GA h−1 mg−1 protein), and Digitalis purpurea (494.8 ng GA h−1 mg−1 protein). The mean value across all species was 275.9 ng GA h−1 mg−1 protein.

Keywords

GA, glufosinate (racemic mixture)DGA, D-glufosinateLGA, L-glufosinateMPA, 2-(hydroxymethylphosphinyl)acetic acidMPB, 4-(hydroxymethylphosphinyl)butanoic acidMPP, 3-(hydroxymethylphosphinyl)propionic acidPPO, 2-oxo-4-(hydroxymethylphosphinyl) butanoic acidAgrostemma githago L. AGOGI, corn cockleAvena fatua L. AVEFA, wild oatDigitalis purpurea L. DIKPU, foxgloveFumaria officinalis L. FUMOF, fumitoryGalium verum L. GALVE, yellow bedstrawGeum urbanum L. GEUUR, common avensMalva sylvestris L. MALSI, high mallowAutoradiographyexcised shoots and leavesAGOGIALOMYAMAREAVEFACMAALCHQMACHEALDIKPUFUMOFGALAPGALVEGEUURGERROLOLPELYTHYMALSIMATCHPOAPRSINARDAUCA
Type
Research Article
Information
Weed Science , Volume 48 , Issue 3 , June 2000 , pp. 319 - 326
Copyright
Copyright © Weed Science Society of America 

Access options

Get access to the full version of this content by using one of the access options below. (Log in options will check for institutional or personal access. Content may require purchase if you do not have access.)

References

Literature Cited

Anderson, D. M., Swanton, C. J., Hall, J. C., and Mersey, B. G. 1993a. The influence of soil moisture, simulated rainfall and time of application on the efficacy of glufosinate-ammonium. Weed Res. 33:149–160.CrossRefGoogle Scholar
Anderson, D. M., Swanton, C. J., Hall, J. C., and Mersey, B. G. 1993b. The influence of temperature and relative humidity on the efficacy of glufosinate-ammonium. Weed Res. 33:139–147.CrossRefGoogle Scholar
Bradford, M. M. 1976. Protein assay by dye binding. Anal. Biochem. 72:248–254.CrossRefGoogle ScholarPubMed
Dorn, E., Görlitz, G., Heusel, R., and Stumpf, K. 1992. Verhalten von Glufosinat-ammonium in der Umwelt—Abbau und Einfluß auf das Ökosystem. Z. PflKrankh. PflSchutz Sonderheft 8:459–468.Google Scholar
Dröge, W., Broer, I., and Pühler, A. 1992. Transgenic plants containing the phosphinothricin-N-acetyltransferase gene metabolize the herbicide L-phosphinothricin (glufosinate) differently from untransformed plants. Planta 187:142–151.CrossRefGoogle ScholarPubMed
Dröge-Laser, W., Siemeling, U., Pühler, A., and Broer, I. 1994. The metabolism of the herbicide L-phosphinothricin (glufosinate). Plant Physiol. 105:159–166.Google Scholar
Environmental Protection Agency (EPA). 1997. Notice of filing of pesticide petitions. Federal Register 62:52544–52548. Washington, D.C.Google Scholar
Götz, W., Dorn, E., Ebert, E., Leist, K. H., and Köcher, H. 1983. HOE 39866 a new non-selective herbicide: chemical and toxicological properties—mode-of-action and metabolism. Pages 401–404 In 9th Conference Proceedings. Manila, Philippines: Asian Pacific Weed Science Society.Google Scholar
Haas, P. 1986. Verhalten von Glufosinat-Ammonium in Unkräutern. Dissertation, University of Stuttgart-Hohenheim, Germany.Google Scholar
Hoerlein, G. 1994. Glufosinate (phosphinothricin), a natural amino acid with unexpected herbicidal properties. Rev. Environ. Contam. Toxicol. 138:73–145.Google ScholarPubMed
Hopkins, W. L. 1997. Global Herbicide Directory. 2nd ed. Indianapolis, IN: Ag Chem Information Services. 20 p.Google Scholar
Köcher, H. and Kocur, J. 1993. Influence of wetting agents on the foliar uptake and herbicidal activity of glufosinate. Pestic. Sci. 37:155–158.CrossRefGoogle Scholar
Komoßa, D. and Sandermann, H. 1992. Plant metabolism of herbicides with C-P bonds: phosphinothricin. Pestic. Biochem. Physiol. 43:95–102.CrossRefGoogle Scholar
Mersey, B. G., Hall, J. C., Anderson, D. M., and Swanton, C. J. 1990. Factors effecting the herbicidal activity of glufosinate ammonium: absorption, translocation, and metabolism in barley and green foxtail. Pestic. Biochem. Physiol. 37:90–98.CrossRefGoogle Scholar
Metz, P.L.J., Stiekema, W. J., and Nap, J. P. 1998. A transgene-centered approach to the biosafety of transgenic phosphinothricin-tolerant plants. Mol. Breeding 4:335–341.CrossRefGoogle Scholar
Müllner, H., Eckes, P., and Donn, G. 1993. Engineering crop resistance to the naturally occurring glutamine synthetase inhibitor phophinothricin. Pages 38–47 In Duke, S. O., Menn, J. J., and Plimmer, J. R., eds. Pest Control with Enhanced Environmental Safety. Washington, D.C.: American Chemical Society.CrossRefGoogle Scholar
Ridley, S. M. and McNally, S. F. 1985. Effects of phosphinothricin on the isoenzymes of glutamine synthetase isolated from plant species which exhibit varying degrees of susceptibility to the herbicide. Plant Sci. 39:31–36.CrossRefGoogle Scholar
Schwerdtle, F., Bieringer, H., and Finke, M. 1981. HOE 39866—ein neues nicht selektives Blattherbizid. Z. PflKrankh. PflSchutz Sonderheft 9:431–440.Google Scholar
Shelp, B. J., Swanton, C. J., and Hall, J. C. 1992. Glufosinate (phosphinothricin) mobility in young soybean shoots. J. Plant Physiol. 139:626–628.CrossRefGoogle Scholar
Steckel, G. J., Hart, S. E., and Wax, L. M. 1997a. Absorption and translocation of glufosinate in four weed species. Weed Sci. 45:378–381.CrossRefGoogle Scholar
Steckel, G. J., Wax, L. M., Simmons, F. M., and Phillips, W. H. II. 1997b. Glufosinate efficacy on annual weeds is influenced by rate and growth stage. Weed Technol. 11:484–488.CrossRefGoogle Scholar
Tebbe, C. 1988. Abbau des Herbizids Phosphinothricin (Glufosinat) in Boden und Reinkulturen von Mikroorganismen. Dissertation, University of Münster, Germany.Google Scholar
Tebbe, C. and Reber, C. C. 1988. Utilization of the herbicide phosphinothricin as a nitrogen source by soil bacteria. Appl. Microbial Biotechnol. 29:103–105.CrossRefGoogle Scholar